DPCstruct | MC19074
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 123 ± 9 aa |
| Standard deviation of domain lengths | 9.36 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 89.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.20 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7H0M6J1 | 132-242 | GLVALTAYAAGILAGAVAAPILLPWIPGRAFAVKGTLTGIVAGLAVVLIFKNSISWVESSALILITVAISSYLAMNFTGSTPYTSPS… |
| A0A1V5J6T7 | 1-126 | MTDFGFFAVAALGGAVLAGAVLSPALLPYLPGRAFSVKGFFIGAITAVALLYLRGMNFSTWPDRIEALSWIFIVPAIASYLAMNFTG… |
| A0A7X8E6X2 | 1-135 | None |
| A0A1G6BW35 | 46-165 | None |
| A0A1V5KFX9 | 88-201 | None |
| A0A2N6F9V9 | 177-292 | None |
| A0A1F9VH20 | 231-365 | None |
| A0A7H0M6F1 | 124-244 | None |
| A0A7Y2JDK3 | 59-176 | None |
| A0A524A383 | 387-525 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.