DPCstruct | MC19072
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 108 ± 21 aa |
| Standard deviation of domain lengths | 21.45 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 74.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 46.79 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0497- CL0029 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A067D7A1 | 174-267 | TVSTQAYPKLQALVAALRKSDKLRTYYASKFMFTSRSISKSFVSVAQREGVGATVRRSIGHPMLRRLDPFLMLDEFHVQLPGGFPDH… |
| A0A094CM47 | 42-140 | QTATTSSSNTQTTSTSFEGLPVIPPASIYGEPKAEAMSVPRAIRKAFLAVQQSEGVGAKVRRSIGTPQLRNFSPFLMLDHFTSSPGS… |
| A0A834FF89 | 261-342 | None |
| A0A081CEV4 | 1-115 | None |
| A0A078FXG3 | 1-91 | None |
| A0A453MH22 | 16-136 | None |
| A0A1B7YKN0 | 64-162 | None |
| J3L8G6 | 32-164 | None |
| A0A804M799 | 2-164 | None |
| A0A5D6YKF2 | 21-124 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.