DPCstruct | MC19070
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 223 ± 8 aa |
| Standard deviation of domain lengths | 8.19 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 84.32 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 28.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04108 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0ENP7 | 11-224 | EPISEEERKEMLDVLEKDASQVDDVVMELREYLADMEVRHEAIIAHVASQNTTYNETTKAYTILEAVGSRLPTYIAASQDFRLRWTE… |
| A0A094AKC4 | 38-271 | LPDGVTVSGVIPSPAASSHLTPVSPAERNAMLRVLASDATELPAVVQDLDLRLQEMEALLPQISHHVEAARSAYSATTSAFTMLERL… |
| A0A366QVK4 | 711-935 | None |
| A0A4S4M681 | 255-480 | None |
| A0A409VPP4 | 305-530 | None |
| A0A1Y1XK79 | 90-308 | None |
| W7MIF6 | 20-259 | None |
| A0A836DBJ9 | 1-227 | None |
| A0A1Y2GA60 | 111-329 | None |
| A0A0C9YGC8 | 65-279 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.