DPCstruct | MC1907
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 90 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13027 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C2XRF4 | 11-101 | MEDALYSVLFPKINKAIEKQYGSLKPYQCPKIISLKKVYSGTYLFQASIEVTKYEQVGGKIVPPFEKVTITFNNEEGEWEVTKVSVK… |
| A0A0Q9VGD9 | 5-101 | FLRYLGGTILEVMEKHGDSQLFTFNRIEKISRDIQNDTYEVSLHVIGYEGPINPPFKLIQMTIRIPGEKYTKYSVISYKHRYINDKE… |
| A0A5J6SMZ3 | 2-86 | None |
| A0A837GHU9 | 3-72 | None |
| A0A852TID9 | 1-89 | None |
| A0A6A7KBT4 | 5-72 | None |
| A0A7C9LJZ9 | 485-562 | None |
| A0A0E3GSG7 | 56-164 | None |
| A0A1X9MAZ0 | 28-120 | None |
| M8E871 | 39-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.