DPCstruct | MC19069
Metacluster Properties and Pfam Annotations
| Number of structural domains | 825 |
|---|---|
| Mean domain length (aa) | 117 ± 21 aa |
| Standard deviation of domain lengths | 20.59 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 21.78 |
| Pfam Score | 96.28 |
| Assigned Pfam label(s) | CL0550- CL0168- CL0056- CL0692- PF07692 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A834DJ09 | 3-93 | GNLGCYKDHGNPPPLTGASKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWTYGEAASTECNSVCFGDHAQPCGGDGRI… |
| A0A094A294 | 16-135 | ANSLAIEKPAIIRQRDGWSLLGCFTDNVSGRALPNGVSVPGGSGSITNEACQTACLAAGYKVAGTEYGGECWCGNAVTNGGALVSDG… |
| A0A813NX49 | 551-638 | None |
| A0A1A6A6P8 | 138-262 | None |
| A0A813U397 | 20-130 | None |
| A0A6S7HBG0 | 663-768 | None |
| A0A6S7IGX2 | 267-369 | None |
| A0A2K6AUQ2 | 128-233 | None |
| Q2GQ20 | 10-125 | None |
| A0A813R1G5 | 645-774 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.