DPCstruct | MC19067
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 299 ± 43 aa |
| Standard deviation of domain lengths | 43.43 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 33.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2X3CAK6 | 24-279 | VTGLSRSGKTAFITALVNQLLNIHTGARLPLLSAAREERLLGVKRVPQRDFGIPRFTYDEGLAQLYGQPPMWPTPTRGVSEIRLALR… |
| A0A1U9MBR5 | 3-305 | NEKLWPQSTRSLSQLRLKLEFLTRSQKFSGSKQKKLSIDIIDYPGEWLLDLPLLQKNYREFSAQSIARANSPEHKAHAKAWLGAIRS… |
| A0A3M1HN97 | 3-347 | None |
| A0A7C5N2G9 | 2-317 | None |
| A0A090RAF3 | 4-258 | None |
| A0A6G9VWU9 | 8-246 | None |
| A0A0B8PQ23 | 1-248 | None |
| A0A844EWV3 | 18-349 | None |
| A0A353UTU6 | 21-351 | None |
| A0A0P1EPP2 | 249-582 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.