DPCstruct | MC19064
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 152 ± 17 aa |
| Standard deviation of domain lengths | 16.83 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M2DH07 | 8-149 | SRWVKAGFLDDGGEGIVVGRIVFAGIGPVELCLRGGFSGDIAGKLIRFENSQFVDAEQALESLGDFECPQLGTVSLISFDPHPLLVP… |
| A0A5B1CF95 | 1-179 | MAWRPTDWVVEGELDNTTMNWTIGWVRLRDRDEPLQLKLLGNPYPDLAGWKFRIVRPDPIPDWVGEPNYEGIATDQSGTIGDVTADQ… |
| A0A7C7T3M1 | 1-126 | None |
| A0A7X4BYD6 | 1-140 | None |
| A0A7J2RFM2 | 1-156 | None |
| A0A2V5Q930 | 1-170 | None |
| A0A2D5SBJ2 | 1-170 | None |
| A0A350CH68 | 1-130 | None |
| A0A2A2Y959 | 1-151 | None |
| A0A1U9NLL7 | 1-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.