DPCstruct | MC19060
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 95 ± 8 aa |
| Standard deviation of domain lengths | 7.55 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 44.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20046 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A853IWS5 | 2-94 | TFTTFLRTLASSITSLVIRPASAHCDTADGPAVVDGRRALSQGNVNIALKWVMPEGEDELRAAFDRAQRVRAVGGEAAALAEQWFLE… |
| A0A1N6EMB0 | 21-106 | LSPVTASAHCDTMDGPVIGDAQTAIKENNINYIAKWVSPEEEANLTDIFNQTMEVRDDSPEAQELADQYLFENLVRVHRAGEGAPY |
| A0A176YAZ4 | 11-103 | None |
| A0A062UYZ5 | 12-112 | None |
| A0A1V5TSL7 | 11-106 | None |
| A0A2N6UDJ1 | 6-100 | None |
| A0A154QL82 | 19-108 | None |
| A0A285X3K0 | 11-111 | None |
| A0A7T9CJI2 | 45-142 | None |
| A0A7C5F715 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.