DPCstruct | MC19059
Metacluster Properties and Pfam Annotations
| Number of structural domains | 51 |
|---|---|
| Mean domain length (aa) | 75 ± 8 aa |
| Standard deviation of domain lengths | 8.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.85 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y1ZXR6 | 129-202 | QGIAGDKTRVPKAGQQVQWKTIAGFVDGEVVEVVYEEKSVDGKKVKASKEDPRIVLKSSSSGKTAVHKPEAVYF |
| A0A853IUM0 | 3-70 | KASFKVGDHVRWNSEAGHVSGHITKVHQQDFDWKGYTHHASADDPQYEIKSDKTDHVAVHKGRRCTTS |
| A0A3N2EDE5 | 35-107 | None |
| A0A2T0FFP8 | 1-70 | None |
| A0A060SCT6 | 38-110 | None |
| A0A401GUY4 | 23-98 | None |
| A0A072PNT5 | 44-111 | None |
| W6QBA5 | 1-67 | None |
| A0A4Y7Q6X3 | 3-74 | None |
| A0A3N4LHZ2 | 2-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.