DPCstruct | MC19058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 48 |
|---|---|
| Mean domain length (aa) | 98 ± 20 aa |
| Standard deviation of domain lengths | 20.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0057 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R9KPZ3 | 27-120 | HEKSIINGKLYDTEKAEFLCPFKDGRILLKTKKGNYFSCVQDIRSVNKEKMDEIIEAVTISHYDLREETKEEVKGYMGIHELDLYIK… |
| A0A1I2D4U1 | 1-107 | MKKIVNEKLYNTETAHRVGTYRFDFDDGVQHICTTLYRDRDGEYFLYNRSAGVPVTNVAEEFGGQIIRESIIPMTPDAAKKWTERYL… |
| A0A327KZA4 | 1-129 | None |
| A0A7C6STZ1 | 12-109 | None |
| A0A1T4WRL4 | 1-74 | None |
| A0A6N8I0I2 | 1-77 | None |
| A0A7X2TCU3 | 272-358 | None |
| A0A4Y7RLD1 | 2-64 | None |
| A0A514LM43 | 1-145 | None |
| A0A1V5ILR1 | 1-88 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.