DPCstruct | MC19055
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 450 ± 138 aa |
| Standard deviation of domain lengths | 138.22 |
| Length coefficient of variation | 0.31 |
| Mean AlphaFold2 pLDDT confidence score | 82.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.96 |
| Pfam Score | 79.49 |
| Assigned Pfam label(s) | PF12359- PF12340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5CTH5 | 22-513 | VRAEQWLATTCRDVLDESDEILDPRFQLVYSIGNQRLMDGQPDRWVITQRLLSLFADQARVLQAQGNQGVEVDSRTRSYPRITFLDH… |
| A0A5N5D1F2 | 285-798 | MSFRLMGRERLQTQPQLAWEMVGLERWLGVTCRDVLDESDAILDPRFQLVYSMGTQRIMDGQPERWVITQRVLALFAREASRLQTEG… |
| A0A821GH09 | 150-890 | None |
| A0A2K0TT10 | 1-241 | None |
| A0A194XJ18 | 11-563 | None |
| A0A820TGL9 | 6-464 | None |
| A0A812J0P5 | 2-328 | None |
| A0A2K0TVX9 | 12-315 | None |
| A0A822DX26 | 315-1003 | None |
| A0A842Z362 | 10-379 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.