DPCstruct | MC19053
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 100 ± 7 aa |
| Standard deviation of domain lengths | 6.78 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.35 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6WKR1 | 141-233 | AAADKIGRWWICLRLDIEPRFDEEKVTKAFTGMDELCIEVWEAQYASCDYTVLKLFANVRAVKKAYVTGSVERKFARWLERAMMSPV… |
| A0A5N5CZT7 | 14-112 | ASVVAQIRNWHISVRLDADPYFNAAEVTAAFSNADSLEVECWQAQFEACDYSVLRLFQDVRGVGRAKVSGSVGYGFAHWLELVMESP… |
| A0A0A1T4K9 | 116-220 | None |
| A0A177AKA9 | 88-184 | None |
| A0A1G4AS11 | 88-199 | None |
| A0A395IFW2 | 32-128 | None |
| A0A4Z1NST9 | 5-92 | None |
| A0A6A5R9I0 | 93-189 | None |
| A0A3M7B530 | 872-980 | None |
| A0A3M7IX98 | 135-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.