DPCstruct | MC19052
Metacluster Properties and Pfam Annotations
| Number of structural domains | 69 |
|---|---|
| Mean domain length (aa) | 250 ± 39 aa |
| Standard deviation of domain lengths | 39.35 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 27.72 |
| Pfam Score | 79.55 |
| Assigned Pfam label(s) | CL0023- PF12359- PF12340 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A022XFS6 | 37-281 | IKIHDWMQTVCRDVLDECDYTLAPRTQLIYPSGTQCTVDGHPHRWQTAEKLLELVSGHIWGLWQRYPGSIEVIQRPKGGFPIVYFLR… |
| A0A5N5CTH5 | 9-269 | ERLQTQPELGWQLVRAEQWLATTCRDVLDESDEILDPRFQLVYSIGNQRLMDGQPDRWVITQRLLSLFADQARVLQAQGNQGVEVDS… |
| A0A820TGL9 | 6-200 | None |
| A0A820T5Z1 | 41-256 | None |
| A0A0D2G9G7 | 4-228 | None |
| A0A822DX26 | 354-654 | None |
| H0EN30 | 364-598 | None |
| A0A2K0UV93 | 858-1147 | None |
| A0A834S6Q8 | 5-243 | None |
| A0A6A4DH99 | 528-776 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.