DPCstruct | MC19050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 128 ± 27 aa |
| Standard deviation of domain lengths | 26.71 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.86 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N5CSX4 | 79-219 | NTSIDYDNITMSDTAPDGCFTDEDDSNFIKFGYDYVDEEDSDLDWHIRTCMSSSALKTPIMNGTRDRQDFEEVFYLNISTGITWLEY… |
| A0A842ZBL0 | 126-235 | LSSEIHCKNITRSEFPSSCAGERPINMEINTSGVALRVCVPGDFKKQPWSRTRNREDIEEELYLDLQLSEGFGSSTMHSFTMHCTAS… |
| A0A098D7J4 | 230-385 | None |
| A0A1L9PK29 | 296-406 | None |
| A0A0G4LXJ8 | 64-175 | None |
| C9SEU9 | 202-299 | None |
| T0M2X7 | 213-353 | None |
| A0A6M7YY44 | 2-127 | None |
| A0A4Q4MBR8 | 2-123 | None |
| A0A0F0I806 | 729-959 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.