DPCstruct | MC1905
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.54 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 84.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 25.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N8WIC3 | 1-93 | MTDRAEYIAGLREIADWLEQHPDADLPSTDRLLLPLSTNPAVEEFAATLGLTAEIDEEGNAAVDLKFGPIAFHAYGYADFTEHVKEH… |
| D7B2R2 | 92-198 | PVAGQRERQTLLADLRALVAYLEAHPQLPVGEMTRVEITYFPEGCDGHQQDQVVRLAEALGTRPRREGEHFSCGRWFGQAGYRVVSI… |
| A0A4V2QUB0 | 19-124 | None |
| A0A0F7CPZ1 | 8-94 | None |
| A0A7W8Z909 | 2-105 | None |
| A0A066YT20 | 1-93 | None |
| A0A7X0IJQ9 | 1-108 | None |
| A0A4R5E6K3 | 49-166 | None |
| A0A4Q8BXR7 | 34-147 | None |
| A0A7Y4L4R4 | 19-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.