DPCstruct | MC19049
Metacluster Properties and Pfam Annotations
| Number of structural domains | 114 |
|---|---|
| Mean domain length (aa) | 200 ± 58 aa |
| Standard deviation of domain lengths | 58.03 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 78.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.50 |
| Pfam Score | 85.00 |
| Assigned Pfam label(s) | CL0023- PF07516- PF02810 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A496LV45 | 3-185 | LEYAQCMKIQREITYAERNRLIQAEERIDEEISRVLSQVIHQAAYEQSYETRADLYRFILDHFSYHAERIPYDFDIYSPEKIAELLQ… |
| A0A0G1RLX1 | 49-243 | HRQVIYKLRRRILELGSDYAANEAWLLARLSEHSSQDIAGAWNVHKDAVGEQVWGGVVWNISWPVINLLWMEHLVDMDRIREGIGLH… |
| A0A2M8BJ48 | 2-123 | None |
| A0A6A8IE70 | 493-755 | None |
| A0A831V2S8 | 1-121 | None |
| A0A7X8FUQ7 | 158-407 | None |
| A0A3N9PAY7 | 298-534 | None |
| K2DB85 | 25-193 | None |
| A0A7V2UCT9 | 339-530 | None |
| A0A831XVI6 | 37-259 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.