DPCstruct | MC19048
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 162 ± 28 aa |
| Standard deviation of domain lengths | 27.97 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.79 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 29.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A015NFQ3 | 2-132 | VETVCSMFPNIPPAAVQYDLQKTGSVEVTCDNVLQNGGLPLPPPNVVASFTIPSTTQASTSSTGISTSLTQQSLIEKYKLQDAVKRG… |
| A0A2T9YWG1 | 9-167 | TAIPRNPTHNGGPVLHPVNEQQLQELQIIFPNISPEAIRYDLSKTGSLETTTENILRLGTSLPRPPIENHPLNQASQNTATAINNAG… |
| A0A0J9V8C6 | 62-243 | None |
| A0A1J7JRY0 | 1-194 | None |
| U7PTH2 | 6-245 | None |
| P87238 | 14-206 | None |
| A0A132BD18 | 1-176 | None |
| A0A5N6KYV0 | 97-261 | None |
| A0A507CI24 | 2-149 | None |
| A0A0W0CV05 | 163-353 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.