DPCstruct | MC19045
Metacluster Properties and Pfam Annotations
| Number of structural domains | 210 |
|---|---|
| Mean domain length (aa) | 256 ± 56 aa |
| Standard deviation of domain lengths | 55.97 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 87.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 19.31 |
| Pfam Score | 99.11 |
| Assigned Pfam label(s) | CL0123- CL0063- PF04712 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A356Z8Y2 | 3-151 | QVYACETRPVLQGARLTVWELMQDNIPVTLITDNMAGYVMSRGMVDAVIAGADRIAANGDTANKIGTYGLAVLARYHHIPFYIAAPL… |
| A0A2T9YAM9 | 18-321 | ASHLLSEFADCTDETPLSTVHDFLLCNIEFLKTSRPTAVNLFEAMGLLSSAITKSLLDQPSTPVFVTSFVELCESLLARDIADNKAI… |
| A0A7R9PWL5 | 468-794 | None |
| A0A1B0BSJ1 | 703-1009 | None |
| A0A7V2XSJ5 | 1-290 | None |
| A0A0D9Y1H8 | 300-604 | None |
| A0A388L4Y5 | 256-580 | None |
| A0A084RDQ4 | 865-1179 | None |
| A0A7R9KWT6 | 640-949 | None |
| A0A6S7NKM8 | 135-380 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.