DPCstruct | MC19044
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 181 ± 18 aa |
| Standard deviation of domain lengths | 18.22 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J5WVU2 | 17-167 | WTAYEVEILRRAIIYYGVGNPKKIMQHGCLLTKRPPQITTKTQNLMGQQSLAEFVGLHVDVTRVGKDNAKLKNVLRKGKKIINTSKR… |
| A0A2T9YA99 | 21-196 | DSASLWNCTLSPGWTNDEVAVLRQALIKFGIGNWAKIIESECLLGKTIAQMNLQTQRMLGQQSTAEFSGLHIDPFIIGELNSKKVGP… |
| A0A7S4CGT8 | 2-186 | None |
| I0Z9F1 | 2-174 | None |
| D2VZN2 | 73-238 | None |
| A0A0V0QRF4 | 16-211 | None |
| A0A5J4YDY7 | 1-207 | None |
| A0A078A3S1 | 14-201 | None |
| A0A383W0B8 | 1-165 | None |
| A0A7S1VBX1 | 50-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.