DPCstruct | MC1904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 71 ± 4 aa |
| Standard deviation of domain lengths | 3.74 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 65.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 56.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287QWH7 | 2-65 | DLRRRQRRLVFDRRYGWIFDEWTDPAVAALFGGRGMLCILPMAHSLMSAAASSVDYAADSVRAA |
| A0A484LLV8 | 1-73 | MESSLKLNHRNSNRPAKSLIFDRRYGWVFDEWKDPSDQAMEGGRGMFCVLPLAKALLKIASQTLISSKEIDQK |
| A0A200QVR0 | 77-153 | None |
| A0A834ZFW6 | 1-66 | None |
| K4AG66 | 28-99 | None |
| A0A2P5DWC5 | 1-69 | None |
| A0A835HW61 | 1-74 | None |
| A0A1U7W958 | 1-70 | None |
| A0A803R2W1 | 1-70 | None |
| A0A5C7H950 | 1-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.