DPCstruct | MC19038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 150 ± 17 aa |
| Standard deviation of domain lengths | 17.42 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 37.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A225W1N7 | 151-325 | MRNRPKFFDWQLHAPLIGKYIMGVRRKAKMEAIQERVELLDMCVATWGYYGFLRMFESVPKKERKRLLMFWGGQPGRNSPDSRHYSG… |
| A0A329SE97 | 1-135 | MLSQRRKDKLLVDIACILFTSLWIEAWGYCNFSQRFEESKSGRQLMWMGDQPGRNSADAKTYTRPTIENLYGLFCRNRTEYYRKIKN… |
| A0A6A3ZEU6 | 185-334 | None |
| W2G5Q4 | 1-130 | None |
| A0A6A3QF33 | 29-183 | None |
| W2XXI1 | 2-123 | None |
| W2M3E9 | 3-128 | None |
| W2PRM2 | 73-244 | None |
| W2PPX9 | 225-370 | None |
| A0A6A3UZG6 | 4-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.