DPCstruct | MC19035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 105 ± 8 aa |
| Standard deviation of domain lengths | 8.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 75.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 33.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A3EH85 | 2-83 | GSQLKFLTLDGPRVALDENVILQSCPKLEELAICENFVDVRLTFSEYQANGEPLPLLNCHWNDVIALSADMSDENNPLAKCV |
| A0A329S433 | 9-115 | LTIRFDKWEHVFTNGVPIFLSAVGSSLRFLTVDGLRDDLDERVILDCCPNLESLYLCGGLVDVELSLGEFRIMRQASLQQRIDWQII… |
| A0A329S0D9 | 2-101 | None |
| A0A6A3RLB4 | 1-109 | None |
| A0A6A3RBQ1 | 398-499 | None |
| D0N0X7 | 514-614 | None |
| G4ZFE8 | 101-213 | None |
| W2ZYG3 | 111-218 | None |
| A0A225WZ42 | 1-111 | None |
| A0A329SEK8 | 33-150 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.