DPCstruct | MC19034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 156 ± 18 aa |
| Standard deviation of domain lengths | 17.71 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 31.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0N8U4 | 1-144 | MTVSMTYPVRAFKIIYVLHRLGLLEQVKANPKRAALVFLVPHSGLKGFERQDIISDGVSPHSIKDIHDIGPAAVKTFADKYGIKTVD… |
| A0A329S3S2 | 45-193 | LLFQVTMGETHPVSGEGLAFVLKKLGILEWVSQNQVALIFVVPVNNASNFKLQTVELKHKPNDEGSVRNLHGIGEAKELLLDADGVY… |
| A0A6A3R8T8 | 1-206 | None |
| A0A0W8CMZ0 | 116-263 | None |
| A0A6A3NED2 | 184-335 | None |
| A0A6G0RQ27 | 160-304 | None |
| A0A6A3UJS4 | 21-194 | None |
| A0A662Y013 | 636-784 | None |
| W2ZXK8 | 290-436 | None |
| A0A6G0JJQ1 | 23-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.