DPCstruct | MC19032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 75 ± 7 aa |
| Standard deviation of domain lengths | 7.10 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 94.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 60.67 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R8NI96 | 1-74 | MTLKKLADASVRYSDSTAHNLILKQLGGPSEFEKILREIGDTVTTSERFEPELNEVNPGETHDTSTPEAIAKTL |
| A0A7Y9BIB1 | 3-68 | ELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRWEPELNEAIPNDERDTTMPAAM |
| A0A658G377 | 93-169 | None |
| A0A0Q4IWD7 | 44-117 | None |
| A0A0F0ZVX8 | 45-114 | None |
| A0A4Y5RT87 | 99-180 | None |
| A0A127SFT5 | 115-191 | None |
| A0A1G7Y638 | 27-114 | None |
| A0A5Q8AMI5 | 45-112 | None |
| A0A378EHS6 | 115-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.