DPCstruct | MC1903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 86 ± 2 aa |
| Standard deviation of domain lengths | 2.00 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 82.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 68.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0111 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484MVW4 | 82-165 | MEVVLLLVVHLAYGFSTGAFSYILLTISSWFLAISWLFAPYLFNPSGFEWQKTVEDFRDWTNWLLYRGGIGVKGEESWEAWWDE |
| A0A484L9U7 | 1-87 | MEIVLLLVVYLAYGFSTGALSYILLTISSWFLAISWLFAPYLFNPSGFEWQKTVEDFRDWTNWLLYRGGIGVKGEESWEAWWDEEPV |
| A0A484M3I5 | 1-84 | None |
| A0A287KW22 | 190-277 | None |
| A0A484MC76 | 16-104 | None |
| A0A427AM86 | 184-266 | None |
| A0A1D6NNZ3 | 1640-1725 | None |
| A0A453J6S5 | 273-360 | None |
| A0A834X3U2 | 21-105 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.