DPCstruct | MC19029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 103 ± 19 aa |
| Standard deviation of domain lengths | 18.86 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 28.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J4LPU4 | 113-197 | HPHCVHCGVVKNVSSDRTRGVCYFTGILGTMRELADAQRRLIAKELVSSTGFSDTYAMTGMDQVELFIRTVRKYSNIPVRDIINH |
| A0A382J0A6 | 49-138 | KNQGGEEAKPKGFYILVLNKMKYILKSDLGHAKNAPKLPESQIKLILWDLDQIDGFYDKWWRTESSQVETFIKIVQNRRADLSRKFI… |
| A0A5E4IEM0 | 29-117 | None |
| A0A2V3HIW3 | 38-178 | None |
| A0A7J4FA53 | 4-103 | None |
| A0A7C4XF59 | 2-99 | None |
| A0A533MJS8 | 24-144 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.