DPCstruct | MC19026
Metacluster Properties and Pfam Annotations
| Number of structural domains | 146 |
|---|---|
| Mean domain length (aa) | 134 ± 23 aa |
| Standard deviation of domain lengths | 23.02 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 83.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 18.12 |
| Pfam Score | 98.08 |
| Assigned Pfam label(s) | CL0023- CL0200- CL0172- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E3GXD5 | 7-133 | LEEILAELKVYQEQSEIIKQQIDTIRSTIAELDMLDETLDAIDGKEGAEIFVPIGAGSFALAELKDTKNVIMSVGAGIAIKKSIKDA… |
| A0A7J3CJP3 | 22-149 | DNEQEFEQAYLEFQIIQQQMLQIQEQVKMFENQEKELVIALNAISQLQKIEGKNKVLVPVVNGIFIEGELKKPENFIINIGGNVAVK… |
| A0A5S6QHQ8 | 148-303 | None |
| A0A4T0G9N7 | 28-180 | None |
| A0A3Q0IJ92 | 8-101 | None |
| A0A0V0Q7J7 | 2-109 | None |
| A0A4Y7L7N3 | 235-362 | None |
| A0A1S3P3X8 | 1-121 | None |
| A0A446JU32 | 5-86 | None |
| A0A388KYV9 | 18-156 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.