DPCstruct | MC1902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 255 ± 31 aa |
| Standard deviation of domain lengths | 31.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 72.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 31.86 |
| Pfam Score | 88.33 |
| Assigned Pfam label(s) | CL0175- CL0530 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E1ZBD9 | 9-199 | SARLQSDTPVSTVALEPYVLCRRGDGTTVSAEEVPAEGHTDSRFSVKCRWYRSVVTKGGQYCWVHPEKEAAIQCILCLRCKVDTKKS… |
| A0A484L790 | 1-275 | MVTVAGVHLPSEIPIVGCELTPYVLLRLPDSSVTPDDVPESSPINGQFLRYKWYRIQSDKKTAICSVHPSEQATLQCIGCVKAKIPV… |
| A0A452Y901 | 1-282 | None |
| A0A024GCD4 | 34-287 | None |
| A0A2J8A8A4 | 2-248 | None |
| A0A7S2S908 | 1-285 | None |
| A0A2R6R531 | 1-281 | None |
| A0A426Z520 | 2-209 | None |
| A0A3S3M9Y9 | 1-274 | None |
| A0A2G5EHC1 | 5-228 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.