DPCstruct | MC19019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 107 ± 18 aa |
| Standard deviation of domain lengths | 18.45 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 75.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 35.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11842 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645H8J4 | 45-126 | YTGINPLTGEKVYTPKTQKEKNMQRALLQFKIPKNYNTVKDALIACNREDLIGKGAHCLIGDKEPKNSSNKQNSKNKKSKKR |
| A0A7X7KIV3 | 5-107 | MYYTGVDPLSGEEVFVPRGDRARRLQRALLQFFLPENYVDVRAALEEADRADLIGDGADCLIPSRPPRVADARKPASRQRQNRDKRP… |
| A0A645J121 | 27-116 | None |
| T0D2C1 | 1-104 | None |
| A0A381I6S5 | 1-98 | None |
| A0A5S3RRB3 | 6-92 | None |
| R5GXT8 | 378-491 | None |
| A0A357XUJ5 | 301-435 | None |
| A0A0B8PEE5 | 59-162 | None |
| A0A517Y350 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.