DPCstruct | MC19014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 113 ± 9 aa |
| Standard deviation of domain lengths | 9.01 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 84.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 30.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A142XI59 | 1-110 | MSAHSTAAEFLDLVHKSGIHAPGKLEAALRELDELPDDPNRAAVMLVKNGLLTQFQAKLLLAGKFRGFRFGPYVIRSPLGRGGMGAV… |
| A0A3L7NU13 | 1-110 | MSLPPLGALVDLIIRLRLAPPEALRSVQALIASQSSEEFVDLLEKQQVLTGFQIERLRTGDTDGLVLGDCKLMYRVASGSFARFYRG… |
| A0A286RHY8 | 1-105 | None |
| A0A354GMX5 | 3-124 | None |
| A0A7V3X238 | 3-117 | None |
| A0A142XEJ3 | 3-112 | None |
| L0D9Y1 | 5-122 | None |
| A0A2E3MPZ0 | 1-138 | None |
| A0A1I3QIB8 | 3-104 | None |
| A0A517SMJ9 | 3-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.