DPCstruct | MC19013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 315 ± 15 aa |
| Standard deviation of domain lengths | 15.27 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 84.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 41.45 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12779 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C4YMN3 | 42-329 | EIQVEARGPLHEAFAQPWEKNPAANEPIAKQPPDPIPEEPPDEKPAGANVQWIPGYWQWDEEKKDFIWISGFWRDIPSGRRWIMGYW… |
| A0A7X7F0K1 | 1-302 | MRGFRPITCFLLATPMAMGVYSSSMRTAFGQELPNIPIQDAPETFTDASTDGNIEVMTRGPIHEAFASPINAGGGDPLAVPNQPPEP… |
| A0A7W0M9J7 | 1-316 | None |
| A0A517YHC8 | 1-331 | None |
| A0A1G2ZYF1 | 1-322 | None |
| A0A6M5Z1E5 | 1-329 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.