DPCstruct | MC19012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 273 ± 43 aa |
| Standard deviation of domain lengths | 42.97 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 91.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B9QEE2 | 276-531 | AVSGTTVDVTGTAGDDTFAFTAGDNHQVTVNGVTHEFASLAVTNINFVGGLGNDAIEMTGTNGDETAVMRIGQTTLTGVGYSAIATS… |
| A0A7X7EZ22 | 4-235 | STYYLYAEGFDRMVVASTAGGSDTAKMYGSSGNDTFKADRTYAQFQGDGFYCRADGFSFVLAYGQGGTDTAQLYDSAGDDTFVAGPN… |
| A0A1G3AG41 | 980-1239 | None |
| A0A5C5ZKT1 | 424-737 | None |
| A0A5B9PPA6 | 648-914 | None |
| A0A812PLW7 | 16-299 | None |
| A0A7Y5W424 | 2-267 | None |
| A0A1G2Z6H2 | 6-293 | None |
| A0A7Y5SPM5 | 21-396 | None |
| A0A2S8FX28 | 818-1079 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.