DPCstruct | MC19011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 162 ± 36 aa |
| Standard deviation of domain lengths | 36.16 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 81.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 20.38 |
| Pfam Score | 75.45 |
| Assigned Pfam label(s) | PF14693- PF07949- CL0733 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A078K190 | 57-196 | IPAVLQTRAGQGSSSLVESGQVLPLKIHRDEESGKILKFSIRNDGEQLKVDVPLVFKWLDNCPGIKKAGGSLRSMRSSLKLIGPVEH… |
| A0DGI5 | 138-316 | RSLDDHIIGLWKQHEVAVVIEGRDEFEDIDIVLDYYQVAAVKRRICANVAPIYIRIPGHDGDIRCTLGEIIKDPKSGWPFKVTLRRY… |
| A0A6V7PT10 | 401-582 | None |
| K8EMZ7 | 102-281 | None |
| A0A0D9XLG1 | 1-101 | None |
| A0A1F3JXC1 | 252-384 | None |
| A0A371JKK6 | 46-205 | None |
| A0A7S3N8T4 | 117-298 | None |
| A0A4Y7JD89 | 654-815 | None |
| A0A0V0R005 | 59-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.