DPCstruct | MC1901
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 138 ± 12 aa |
| Standard deviation of domain lengths | 12.18 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 53.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R0FA68 | 1-132 | MPGPGPHLMYAMGSGLCLTSISNGRFGPHHTLFYTINAFFGPDVGSFTEWLGSLFGGSAHALGSSLEDLIHHPFFYILLLGLPLSFL… |
| A0A484L1Z3 | 1-134 | MPGPGPHMIYTLGSGQALTSISNGRFSPHHCLTYCINSFFGPDIGSFCEWLSSTLGLGGYLGSSIEPWIHDPFYYILILGFPLSLLY… |
| A0A507EN81 | 1-156 | None |
| A0A2U1M234 | 1-132 | None |
| A0A059A653 | 1-157 | None |
| A0A7J0GAH7 | 1-131 | None |
| A0A1Y1HUC7 | 1-124 | None |
| I3T9M6 | 1-147 | None |
| A0A0E0KRM0 | 79-215 | None |
| A0A0E0KRL8 | 1-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.