DPCstruct | MC19009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 62 ± 5 aa |
| Standard deviation of domain lengths | 5.35 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 55.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0129 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M0ZHZ1 | 127-184 | LEFFDPSSSSTARPISCSDQRCALGEQSSDSGCSARNQCGYTFQYGDGSGTSGYYVAD |
| A0A078JUK7 | 1-64 | MTYSDPGSSVTTTPISCSDQRCSWGVQSSNSGCSTQNNICAYTFQYGDGSCTSGFFVSDVLQFV |
| A0A2J6K6A8 | 132-190 | None |
| A0A078GM94 | 78-153 | None |
| A0A397Y3L6 | 54-118 | None |
| A0A830CEG9 | 407-461 | None |
| A0A396I2W0 | 41-103 | None |
| A0A835M1Q9 | 27-87 | None |
| A0A6L2L6F5 | 150-212 | None |
| A0A251TCV9 | 80-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.