DPCstruct | MC19008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 3.87 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 87.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 52.56 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D7G166 | 15-83 | VCNVKYVDPSYMIRSVAANSYDQIYCMQLAQNAVHGAMAGYTAFSVGMVNDRTVYLPMEELVAHSPRIV |
| A0A078JHQ2 | 1-63 | MVMNLKYVDPAYMIRTVSTNASNTVYFRLLAQSVVHGAVAGYTSYISSLINRRQTYIPYSVSY |
| A0A4S4DBM4 | 236-301 | None |
| A0A2U1MHV7 | 90-153 | None |
| A0A2J7ZS23 | 196-256 | None |
| A0A6S7MX10 | 136-191 | None |
| A0A7S0LKF9 | 104-161 | None |
| A0A834ZP25 | 253-314 | None |
| A0A392PH64 | 1-59 | None |
| K0SZ25 | 116-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.