DPCstruct | MC1900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 617 ± 88 aa |
| Standard deviation of domain lengths | 87.76 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 18.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20248 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V5LNZ6 | 310-811 | AAQVTAHLGPIVATLDRIGADAAISFPPNGSGRLGMADFHLDFVPPKGVGLALDAGVIKGGGFLSVDAAKGEYAGALELTFQDVIAL… |
| A0A2N2J0I0 | 3-520 | FFLAGVGGLIGIHRTIEVDVLREGVQRGVVENILFPKDVIENISQIISDLTTIFPPAKDQFLIGPMAKITWSTPPLVSIDLGIVIEV… |
| A0A2W6WFD1 | 393-1021 | None |
| A0A4V2Y9V7 | 85-683 | None |
| A0A330MQC4 | 574-1180 | None |
| A0A542KA71 | 19-601 | None |
| A0A0M2UVB2 | 270-935 | None |
| A0A1E7N723 | 276-914 | None |
| A0A369JME3 | 443-1098 | None |
| H5WRH5 | 501-1205 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.