DPCstruct | MC19
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 151 ± 26 aa |
| Standard deviation of domain lengths | 26.39 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 90.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 21.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517XQR3 | 6-125 | FYIAFEGTAARYAALARFFDGLQSAKTALERDAEADRDAVVRNPRWIDLLDADAIEAMSGPEWSLEDLLDCILAGDYELVGLTFDGR… |
| A0A1I4GZL6 | 2-143 | ATNFLEFEISSGDRFLHAVAALDALQQAKTSGSWQDDEYWLGFFDKEARSSFWWPTPEEQEDWYKRWTATPPSRRATDPALQTPWDF… |
| A0A4P5YTY7 | 4-163 | None |
| A0A4S8HNM9 | 7-117 | None |
| A0A1H3G771 | 1-191 | None |
| A0A239B574 | 2-134 | None |
| A0A3P3E2X8 | 27-184 | None |
| A0A5D0QUC4 | 1-188 | None |
| A0A7L5I8Y1 | 5-126 | None |
| A0A1G7CKB4 | 1-190 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.