DPCstruct | MC18999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 180 ± 23 aa |
| Standard deviation of domain lengths | 23.34 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 69.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.00 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6C8A0 | 53-286 | SPLNKKKLLEYKTVIRKITAEDTQRLHRKRLLFKVSIKSHSYSSKDCACSLKMTKEMILIPKHKFEAVLQKQNEDQSKAEVVLNDTP… |
| A0A2A4IZU0 | 245-444 | QTLQRYLHFTEEDRQPLRLPIYSDTFNVDSNESKIGFKNKDRDTKSSFDVESLLDESVSIKSKENEVNSLYTPTQILSLIPKTYNKK… |
| E2BZF2 | 242-441 | None |
| A0A661F5L5 | 26-235 | None |
| A0A7R9AV81 | 109-298 | None |
| A0A4Y1ZR84 | 2-146 | None |
| A0A4Y1ZT55 | 137-345 | None |
| A0A4Y2TN58 | 16-188 | None |
| A0A7J5V5Y7 | 140-307 | None |
| A0A7J5V836 | 1-162 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.