DPCstruct | MC18996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 252 ± 53 aa |
| Standard deviation of domain lengths | 53.35 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 84.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 15.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M3WLJ0 | 15-180 | AHARKLQAEQRDSFIDLYGSDLIVIHGSQVRQKMLAFYRHDYERAGSKGGPWKNPDLPDFDFPADSMVGVIFDEEDGLAFYVEFDVA… |
| A0A6G2S3L5 | 3-243 | VVARIVPVHPATDDWLVSGNLTTYPSVDGPELARAAVQTLTPNPQLLLRNPEMLRRAWEMETEARADFIELFGTDLLVLEPRQAQER… |
| A0A0F9I9F3 | 29-186 | None |
| A0A0K2R5T0 | 1-161 | None |
| A0A354TJE4 | 431-697 | None |
| R9MHG8 | 60-389 | None |
| A0A7X9H095 | 37-330 | None |
| A0A6M8BDN4 | 30-314 | None |
| A0A2T0LH62 | 89-374 | None |
| A0A1F7V366 | 148-371 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.