DPCstruct | MC18992
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 238 ± 56 aa |
| Standard deviation of domain lengths | 55.94 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 90.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 21.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832SG89 | 1-250 | SGRGQASDAEIRAEGLNLVMGTTPGIIAIIGCPNYPAGTKDVYNIAEEFLKRNYLVVVSGCSAMDIGMYKDDDGKTLYERYPGTFSG… |
| A0A849J905 | 32-276 | IDIPQHKSTAVVGLSVEAILEILSKVDPTDPIKPVIDNVVNGNIFGFAGIVGCSSIRFRDGAMTEEMVKRLLAQNVLVVTTGCTAHI… |
| A0A7C1PMR9 | 280-591 | None |
| A0A7C2W742 | 186-548 | None |
| A0A7C2W6Y7 | 5-366 | None |
| A0A1V5GJ16 | 2-184 | None |
| A0A7J0BM82 | 304-557 | None |
| A0A6I6JP96 | 35-261 | None |
| R7MI49 | 1-146 | None |
| A0A0F9RDZ9 | 364-708 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.