DPCstruct | MC18988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 114 ± 2 aa |
| Standard deviation of domain lengths | 1.85 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 86.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 29.44 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A661R629 | 34-148 | LDRLLSEWTQTLLANLDDPTTKENLKLLKSQSRELVDNFLQNKALPDELDYDFIQALREVLSGLVKIEVKIDALKTALLKGGTPVTM… |
| A0A7Y3PIL4 | 1-116 | QLDAMVAAWTSTILSNLEDPITQANMDLLKIDDREPLDAFIKSKELPVPLDSNFVHALKEVLSGLVKVTVKAQELHTALQVTDGPAT… |
| A0A2N2PE61 | 295-407 | None |
| A0A7C6SXR7 | 210-324 | None |
| A0A7X8K465 | 1-110 | None |
| F5L602 | 510-623 | None |
| A0A4Q3BI34 | 86-201 | None |
| A0A0B7MMS9 | 705-819 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.