DPCstruct | MC18986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 90 ± 9 aa |
| Standard deviation of domain lengths | 9.02 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.68 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0103 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5H4C4 | 1-86 | MDFGHFSEDGKEFIIENVETPSPWINYLQNGKYFALISNNGGGFSYLKSPLYGRITRYRINDVPPDRPGKYIYIKDLDTGEYWSLT |
| X1F450 | 3-83 | TYGYFDDKNREYVIKRPDTPLPWINYLGCEKYFGIISNTAGGYSFYMDARLRRITRYRYNNVPVDTGGRYLYIKDGDTVWN |
| G6EK92 | 328-427 | None |
| A0A1V5U4C4 | 1-93 | None |
| A0A1C6G8X5 | 9-86 | None |
| W5YL73 | 251-354 | None |
| A0A7V6DCI6 | 6-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.