DPCstruct | MC18985
Metacluster Properties and Pfam Annotations
| Number of structural domains | 865 |
|---|---|
| Mean domain length (aa) | 287 ± 67 aa |
| Standard deviation of domain lengths | 66.70 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 76.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 14.44 |
| Pfam Score | 95.48 |
| Assigned Pfam label(s) | PF05300- PF10163- CL0113- PF09781- PF13127 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A370HK79 | 7-282 | AWGSGLLGVIIFSGSLPATRVAVGGFSPLFLTSARAVIAALLAAAFLVALRQARPGRGDLRPLAVVALGVVVGFPLLTALALQHITS… |
| A0A7V1PU88 | 19-286 | SSTWLFIKLGLESMPPFYSAGWRFLVAAFVLFAYGRYLNIPFPRDGHSHRFLFLFGLSIFTISYGLVYWGEQYLSSGLTSVLFSVMP… |
| A0A0V0QDK1 | 2-212 | None |
| A0A011Q7A1 | 26-221 | None |
| A0A0K0EE59 | 11-270 | None |
| A0A654ET66 | 4-398 | None |
| A0A6P6GIM8 | 5-391 | None |
| A0A1D2NA80 | 10-233 | None |
| A0A1D2NA91 | 101-420 | None |
| A0A1R3J746 | 239-619 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.