DPCstruct | MC18982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 285 ± 61 aa |
| Standard deviation of domain lengths | 61.21 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 88.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 24.54 |
| Pfam Score | 94.22 |
| Assigned Pfam label(s) | PF00710- CL0465- CL0036- PF17763 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3DI46 | 223-513 | EALIEAVPEIKRLANVKGEQIVKIGSQDMSDDVWLKLAKAINAQCKDTDGFVITHGTDTMEETAYFLDLTAKCEKPIVLVGAMRPAT… |
| A0A0A2W3Q6 | 639-928 | SGHLQRQLAMMPEFHRPEMPDFTIHEYDPLMDSSDMTPEDWQHIADDIKAHYDEYDGFVILHGTDTMAFTASALSFMLENLSKPVIV… |
| A0A812IVN5 | 1-272 | None |
| A0A4U0VJC4 | 29-376 | None |
| A0A4U0Y0D1 | 1-238 | None |
| Q6FT22 | 115-411 | None |
| A0A1Y1V1P7 | 101-435 | None |
| A0A1R0H910 | 3-249 | None |
| U6L5J4 | 137-479 | None |
| A0A395STG8 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.