DPCstruct | MC18981
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 251 ± 33 aa |
| Standard deviation of domain lengths | 33.39 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 62.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.61 |
| Mean length-normalized TM-Score | 0.34 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 25.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5J5F4A7 | 15-293 | ARAFTWSLVLLCVFMATARAQEILVFNSTTGLPDCAYSCTDLYSAQYDCQHYTGNRTSCFCETSYIDTKPKGWGCDEVCPINTDRQR… |
| A0A0A2W2K8 | 1-227 | MAAQGPVTTIVPFGDRNKLPACAVSCKALYDANANCVPPVIPSGPVSNYEACFCINQNVVALSTATDAVCNDVCSGEQGGQSSVASW… |
| W2RQ77 | 7-217 | None |
| A0A3M6WYU6 | 162-453 | None |
| A0A2K9YEN1 | 8-200 | None |
| A0A3N4LWS0 | 1-252 | None |
| A0A0D9NWP3 | 112-344 | None |
| A0A0D2B048 | 17-278 | None |
| A0A7H8QLG6 | 1-302 | None |
| A0A6G1GM15 | 1-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.