DPCstruct | MC1898
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 78 ± 7 aa |
| Standard deviation of domain lengths | 7.32 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 46.61 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A645B9B1 | 18-84 | VADDIDHRCAYCYEHRVEETARYAAEHGFAAFTSTLLASIYQNHDKIAEAAERFAKQYGVRFLYRDF |
| A0A7Y7YDW2 | 7-84 | MEPERCVRCTLCFEMRFERTALYALEHGFSVISSSLGISRWKDMKQITDSGIRSARKYPGVTDWDYNWRKSGGVARDR |
| A0A423Q1S8 | 88-171 | None |
| K2DP42 | 8-90 | None |
| R7BBT6 | 22-96 | None |
| A0A7R9YKK5 | 50-124 | None |
| A0A484Z4R6 | 19-92 | None |
| A0A837DWK9 | 60-131 | None |
| A0A5M8FLD3 | 81-177 | None |
| A0A776X3U3 | 44-127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.