DPCstruct | MC18979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 105 ± 11 aa |
| Standard deviation of domain lengths | 10.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 42.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0XVH4 | 11-105 | LGLLSSVYAQPCPDYLAYAKEYHAPFSSGRYNMSYQRPSPNCRTFVSQGVEDAITRVKGDIADPDLSRLFENSYPNTLDTAVKWKGY… |
| A0A0A2VVS7 | 1-103 | MKYNLVLAALAGLAAAAADCPAYEQYARQRHEPFSRGKYKFPYQRPAKECRSYAVPDVERVLDDMKRKVRDPDLYQLFLNTWPNTVD… |
| A0A5N5QFY3 | 663-765 | None |
| A0A2N6NQ05 | 14-111 | None |
| A0A369GMZ1 | 2-132 | None |
| A0A1Z5SVR0 | 1-99 | None |
| A0A0N1GXK1 | 4-120 | None |
| A0A0A2K8H3 | 1-123 | None |
| A0A2S6CG35 | 20-121 | None |
| A0A5M9JMJ2 | 37-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.