DPCstruct | MC18978
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 148 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 73.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 36.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B8FLB5 | 8-148 | DAVSRYEDLRNENSGAVIENPLAHLNQEQLLHDVDTFAVSMSFPDDIRRGLRRAALVAQNTLIYDEVSRDRHSGTYLPVQLTDDEKH… |
| A0A0A2VVC1 | 1-149 | MSHDISKAAVADIYAEKGTTHAEDVVAERNLESRIRNPLDGIPRDELMRNVDDFARSRGLSEHISILRKGALVAQNPTDLDRIDGDE… |
| A0A2A9NXI2 | 22-172 | None |
| F0XFX1 | 1-135 | None |
| A0A0I9XIY1 | 21-164 | None |
| B8N1L0 | 7-150 | None |
| B8N5N8 | 1-147 | None |
| A0A4S9AXF2 | 1-172 | None |
| A0A0N0DD37 | 24-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.