DPCstruct | MC18976
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 83 ± 5 aa |
| Standard deviation of domain lengths | 5.42 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 75.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 51.91 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0A2VS02 | 1-84 | MTNGSGRALFHESEDIERLNRVWARQESLRLRAGSEDAKIYDGVKYERKPTGPFMGKLVSQGTIITIDGEDYVEYRVLTKPSFF |
| A0A0D2Y4N0 | 96-179 | GVAVNGRQQLHERDEMQRLNKVWARQESLRLRTNAEDAKMYAGVKYERKTQGPFTGKLVSQGTIINIDGEDYIEYRVLAKPSFF |
| A0A014P0D9 | 585-666 | None |
| A0A0B4HNS3 | 59-141 | None |
| A0A179F1F6 | 116-198 | None |
| A0A179EXR7 | 196-278 | None |
| A0A2S4L162 | 1-69 | None |
| A0A218ZFI5 | 445-528 | None |
| A0A2T2ZYU5 | 428-509 | None |
| K1WUE3 | 1088-1171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.